![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d3mi0b_: 3mi0 B: [181240] Other proteins in same PDB: d3mi0r2, d3mi0v2 automated match to d1q5qa_ complexed with dmf, sa6 |
PDB Entry: 3mi0 (more details), 2.2 Å
SCOPe Domain Sequences for d3mi0b_:
Sequence, based on SEQRES records: (download)
>d3mi0b_ d.153.1.4 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava alragsadtsggdqptlgvaslevavldanrprrafrritgsalqal
>d3mi0b_ d.153.1.4 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava alragaslevavldanrprrafrritgsalqal
Timeline for d3mi0b_:
![]() Domains from other chains: (mouse over for more information) d3mi01_, d3mi02_, d3mi0a_, d3mi0c_, d3mi0d_, d3mi0e_, d3mi0f_, d3mi0g_, d3mi0h_, d3mi0i_, d3mi0j_, d3mi0k_, d3mi0l_, d3mi0m_, d3mi0n_, d3mi0o_, d3mi0p_, d3mi0q_, d3mi0r1, d3mi0r2, d3mi0s_, d3mi0t_, d3mi0u_, d3mi0v1, d3mi0v2, d3mi0w_, d3mi0x_, d3mi0y_, d3mi0z_ |