Lineage for d3mi01_ (3mi0 1:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2554266Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries)
  8. 2554267Domain d3mi01_: 3mi0 1: [181237]
    Other proteins in same PDB: d3mi0r2, d3mi0v2
    automated match to d1q5qa_
    complexed with dmf, sa6

Details for d3mi01_

PDB Entry: 3mi0 (more details), 2.2 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome at 2.2 A
PDB Compounds: (1:) Proteasome subunit alpha

SCOPe Domain Sequences for d3mi01_:

Sequence, based on SEQRES records: (download)

>d3mi01_ d.153.1.4 (1:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
lragsadtsggdqptlgvaslevavldanrprrafrritgsalqall

Sequence, based on observed residues (ATOM records): (download)

>d3mi01_ d.153.1.4 (1:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
lralgvaslevavldanrprrafrritgsalqall

SCOPe Domain Coordinates for d3mi01_:

Click to download the PDB-style file with coordinates for d3mi01_.
(The format of our PDB-style files is described here.)

Timeline for d3mi01_: