SCOP 1.71: Domain d3ezea1: 3eze A:22-144

Lineage for d3ezea1 (3eze A:22-144)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.10: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47831] (1 family)

5. Family a.60.10.1: Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47832] (1 protein)

6. Protein Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain [47833] (1 species)
   inserted in the phosphohistidine domain

7. Species Escherichia coli [TaxId:562] [47834] (11 PDB entries)

8. Domain d3ezea1: 3eze A:22-144 [18121]
   Other proteins in same PDB: d3ezea2, d3ezeb_
   complexed with po3

Details for d3ezea1

PDB Entry: 3eze

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezea1:

Sequence; same for both SEQRES and ATOM records:

>d3ezea1 a.60.10.1 (A:22-144) Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain {Escherichia coli}
deividrkkisadqvdqeverflsgrakasaqletiktkagetfgeekeaifeghimlle
deeleqeiialikdkhmtadaaaheviegqasaleelddeylkeraadvrdigkrllrni
lgl

Timeline for d3ezea1:

• d3ezea1 first appeared (with stable ids) in SCOP 1.55
  
• d3ezea1 appears in SCOP 1.69
  
• d3ezea1 appears in SCOP 1.73
  
• d3ezea1 appears in the current release, SCOPe 2.08