Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [190203] (5 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187086] (10 PDB entries) |
Domain d3mgrg_: 3mgr G: [181204] Other proteins in same PDB: d3mgra_, d3mgre_ automated match to d1kx5c_ protein/DNA complex; complexed with cl, mn, rb |
PDB Entry: 3mgr (more details), 2.3 Å
SCOPe Domain Sequences for d3mgrg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgrg_ a.22.1.1 (G:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3mgrg_: