SCOPe 2.01: Domain d3mgre_: 3mgr E:

Lineage for d3mgre_ (3mgr E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (38 PDB entries)

8. Domain d3mgre_: 3mgr E: [181203]
   Other proteins in same PDB: d3mgrc_, d3mgrg_
   automated match to d1kx5a_
   protein/DNA complex; complexed with cl, mn, rb

Details for d3mgre_

PDB Entry: 3mgr, 2.3 Å

PDB Description: binding of rubidium ions to the nucleosome core particle

PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3mgre_:

Sequence; same for both SEQRES and ATOM records:

>d3mgre_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d3mgre_:

• d3mgre_ is new in SCOPe 2.01-stable
  
• d3mgre_ appears in SCOPe 2.02
  
• d3mgre_ appears in the current release, SCOPe 2.08