Lineage for d3mg82_ (3mg8 2:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045292Domain d3mg82_: 3mg8 2: [181165]
    Other proteins in same PDB: d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8l_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8z_
    automated match to d1g0u2_
    complexed with l3t, mes, mg

Details for d3mg82_

PDB Entry: 3mg8 (more details), 2.59 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 16
PDB Compounds: (2:) Proteasome component PRE3

SCOPe Domain Sequences for d3mg82_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg82_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3mg82_:

Click to download the PDB-style file with coordinates for d3mg82_.
(The format of our PDB-style files is described here.)

Timeline for d3mg82_: