Lineage for d3mg7l_ (3mg7 L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993576Domain d3mg7l_: 3mg7 L: [181152]
    Other proteins in same PDB: d3mg71_, d3mg72_, d3mg7a_, d3mg7b_, d3mg7c_, d3mg7d_, d3mg7e_, d3mg7f_, d3mg7h_, d3mg7i_, d3mg7j_, d3mg7k_, d3mg7m_, d3mg7n_, d3mg7o_, d3mg7p_, d3mg7q_, d3mg7r_, d3mg7s_, d3mg7t_, d3mg7v_, d3mg7w_, d3mg7x_, d3mg7y_
    automated match to d1g0ul_
    complexed with l2t, mes, mg

Details for d3mg7l_

PDB Entry: 3mg7 (more details), 2.78 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 8
PDB Compounds: (L:) Proteasome component C5

SCOPe Domain Sequences for d3mg7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg7l_ d.153.1.4 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3mg7l_:

Click to download the PDB-style file with coordinates for d3mg7l_.
(The format of our PDB-style files is described here.)

Timeline for d3mg7l_: