Lineage for d3mg6u_ (3mg6 U:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936416Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1936487Domain d3mg6u_: 3mg6 U: [181135]
    Other proteins in same PDB: d3mg61_, d3mg62_, d3mg6a_, d3mg6b_, d3mg6c_, d3mg6d_, d3mg6e_, d3mg6f_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6m_, d3mg6n_, d3mg6o_, d3mg6p_, d3mg6q_, d3mg6r_, d3mg6s_, d3mg6t_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_
    automated match to d1g65g_
    complexed with lzt, mes, mg

Details for d3mg6u_

PDB Entry: 3mg6 (more details), 2.6 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 6
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3mg6u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg6u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3mg6u_:

Click to download the PDB-style file with coordinates for d3mg6u_.
(The format of our PDB-style files is described here.)

Timeline for d3mg6u_: