Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3mg6u_: 3mg6 U: [181135] Other proteins in same PDB: d3mg62_, d3mg6a_, d3mg6b_, d3mg6c_, d3mg6e_, d3mg6f_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6n_, d3mg6o_, d3mg6p_, d3mg6q_, d3mg6s_, d3mg6t_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_ automated match to d1g65g_ complexed with lzt, mes, mg |
PDB Entry: 3mg6 (more details), 2.6 Å
SCOPe Domain Sequences for d3mg6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg6u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3mg6u_: