Lineage for d3mg6t_ (3mg6 T:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1437897Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1437913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (45 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438002Domain d3mg6t_: 3mg6 T: [181134]
    Other proteins in same PDB: d3mg61_, d3mg62_, d3mg6d_, d3mg6g_, d3mg6h_, d3mg6i_, d3mg6j_, d3mg6k_, d3mg6l_, d3mg6m_, d3mg6n_, d3mg6r_, d3mg6u_, d3mg6v_, d3mg6w_, d3mg6x_, d3mg6y_, d3mg6z_
    automated match to d1g65f_
    complexed with lzt, mes, mg

Details for d3mg6t_

PDB Entry: 3mg6 (more details), 2.6 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 6
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3mg6t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg6t_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein

SCOPe Domain Coordinates for d3mg6t_:

Click to download the PDB-style file with coordinates for d3mg6t_.
(The format of our PDB-style files is described here.)

Timeline for d3mg6t_: