![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
![]() | Domain d3mg0g_: 3mg0 G: [181094] Other proteins in same PDB: d3mg01_, d3mg02_, d3mg0a_, d3mg0b_, d3mg0c_, d3mg0d_, d3mg0e_, d3mg0f_, d3mg0h_, d3mg0i_, d3mg0j_, d3mg0k_, d3mg0l_, d3mg0m_, d3mg0n_, d3mg0o_, d3mg0p_, d3mg0q_, d3mg0r_, d3mg0s_, d3mg0t_, d3mg0v_, d3mg0w_, d3mg0x_, d3mg0y_, d3mg0z_ automated match to d1g65g_ complexed with bo2 |
PDB Entry: 3mg0 (more details), 2.68 Å
SCOPe Domain Sequences for d3mg0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg0g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3mg0g_:
![]() Domains from other chains: (mouse over for more information) d3mg01_, d3mg02_, d3mg0a_, d3mg0b_, d3mg0c_, d3mg0d_, d3mg0e_, d3mg0f_, d3mg0h_, d3mg0i_, d3mg0j_, d3mg0k_, d3mg0l_, d3mg0m_, d3mg0n_, d3mg0o_, d3mg0p_, d3mg0q_, d3mg0r_, d3mg0s_, d3mg0t_, d3mg0u_, d3mg0v_, d3mg0w_, d3mg0x_, d3mg0y_, d3mg0z_ |