Lineage for d3mg0g_ (3mg0 G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228502Domain d3mg0g_: 3mg0 G: [181094]
    Other proteins in same PDB: d3mg01_, d3mg02_, d3mg0a_, d3mg0b_, d3mg0c_, d3mg0d_, d3mg0e_, d3mg0f_, d3mg0h_, d3mg0i_, d3mg0j_, d3mg0k_, d3mg0l_, d3mg0m_, d3mg0n_, d3mg0o_, d3mg0p_, d3mg0q_, d3mg0r_, d3mg0s_, d3mg0t_, d3mg0v_, d3mg0w_, d3mg0x_, d3mg0y_, d3mg0z_
    automated match to d1g65g_
    complexed with bo2

Details for d3mg0g_

PDB Entry: 3mg0 (more details), 2.68 Å

PDB Description: structure of yeast 20s proteasome with bortezomib
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3mg0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg0g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3mg0g_:

Click to download the PDB-style file with coordinates for d3mg0g_.
(The format of our PDB-style files is described here.)

Timeline for d3mg0g_: