Lineage for d3mg01_ (3mg0 1:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677629Domain d3mg01_: 3mg0 1: [181087]
    Other proteins in same PDB: d3mg0a_, d3mg0b_, d3mg0c_, d3mg0e_, d3mg0f_, d3mg0g_, d3mg0o_, d3mg0p_, d3mg0q_, d3mg0s_, d3mg0t_, d3mg0u_
    automated match to d1g0u1_
    complexed with bo2

Details for d3mg01_

PDB Entry: 3mg0 (more details), 2.68 Å

PDB Description: structure of yeast 20s proteasome with bortezomib
PDB Compounds: (1:) Proteasome component PRE4

SCOPe Domain Sequences for d3mg01_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg01_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d3mg01_:

Click to download the PDB-style file with coordinates for d3mg01_.
(The format of our PDB-style files is described here.)

Timeline for d3mg01_: