![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d3mfey_: 3mfe Y: [181071] automated match to d1q5qa_ mutant |
PDB Entry: 3mfe (more details), 2.6 Å
SCOPe Domain Sequences for d3mfey_:
Sequence, based on SEQRES records: (download)
>d3mfey_ d.153.1.4 (Y:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr agsadtsggdqptlgvaslevavldanrprrafrritgsalqall
>d3mfey_ d.153.1.4 (Y:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr agsvaslevavldanrprrafrritgsalqall
Timeline for d3mfey_:
![]() Domains from other chains: (mouse over for more information) d3mfe1_, d3mfe2_, d3mfea_, d3mfeb_, d3mfec_, d3mfed_, d3mfee_, d3mfef_, d3mfeg_, d3mfeh_, d3mfei_, d3mfej_, d3mfek_, d3mfel_, d3mfem_, d3mfen_, d3mfeo_, d3mfep_, d3mfeq_, d3mfer_, d3mfes_, d3mfet_, d3mfeu_, d3mfev_, d3mfew_, d3mfex_, d3mfez_ |