SCOPe 2.01: Domain d1flob1: 1flo B:2-129

Lineage for d1flob1 (1flo B:2-129)

Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds)
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
Protein Flp recombinase [47829] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47830] (3 PDB entries)
Domain d1flob1: 1flo B:2-129 [18107]
Other proteins in same PDB: d1floa2, d1flob2, d1floc2, d1flod2
protein/DNA complex; complexed with phs

Details for d1flob1

PDB Entry: 1flo (more details), 2.65 Å

PDB Description: FLP Recombinase-Holliday Junction Complex I

PDB Compounds: (B:) flp recombinase

SCOPe Domain Sequences for d1flob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flob1 a.60.9.1 (B:2-129) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pqfdilcktppkvlvrqfverferpsgekialcaaeltylcwmithngtaikratfmsyn
tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyygqkhqsditdivs
slqlqfes

SCOPe Domain Coordinates for d1flob1:

Click to download the PDB-style file with coordinates for d1flob1.
(The format of our PDB-style files is described here.)

Timeline for d1flob1: