Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries) |
Domain d3mfet_: 3mfe T: [181066] automated match to d1q5qh_ mutant |
PDB Entry: 3mfe (more details), 2.6 Å
SCOPe Domain Sequences for d3mfet_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mfet_ d.153.1.4 (T:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
Timeline for d3mfet_:
View in 3D Domains from other chains: (mouse over for more information) d3mfe1_, d3mfe2_, d3mfea_, d3mfeb_, d3mfec_, d3mfed_, d3mfee_, d3mfef_, d3mfeg_, d3mfeh_, d3mfei_, d3mfej_, d3mfek_, d3mfel_, d3mfem_, d3mfen_, d3mfeo_, d3mfep_, d3mfeq_, d3mfer_, d3mfes_, d3mfeu_, d3mfev_, d3mfew_, d3mfex_, d3mfey_, d3mfez_ |