Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) |
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
Protein Recombinase XerD [47827] (1 species) |
Species Escherichia coli [TaxId:562] [47828] (1 PDB entry) |
Domain d1a0pa1: 1a0p A:3-100 [18105] Other proteins in same PDB: d1a0pa2 |
PDB Entry: 1a0p (more details), 2.5 Å
SCOP Domain Sequences for d1a0pa1:
Sequence, based on SEQRES records: (download)
>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]} qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer leggykatssarllsavrrlfqylyrekfreddpsahl
>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]} qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer lssarllsavrrlfqylyrekfreddpsahl
Timeline for d1a0pa1: