SCOP 1.73: Domain d1a0pa1: 1a0p A:3-100

Lineage for d1a0pa1 (1a0p A:3-100)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Recombinase XerD [47827] (1 species)

7. Species Escherichia coli [TaxId:562] [47828] (1 PDB entry)

8. Domain d1a0pa1: 1a0p A:3-100 [18105]
   Other proteins in same PDB: d1a0pa2

Details for d1a0pa1

PDB Entry: 1a0p, 2.5 Å

PDB Description: site-specific recombinase, xerd

PDB Compounds: (A:) site-specific recombinase xerd

SCOP Domain Sequences for d1a0pa1:

Sequence, based on SEQRES records:

>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
leggykatssarllsavrrlfqylyrekfreddpsahl

Sequence, based on observed residues (ATOM records):

>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
lssarllsavrrlfqylyrekfreddpsahl

Timeline for d1a0pa1:

• d1a0pa1 first appeared (with stable ids) in SCOP 1.55, called d1a0p_1
  
• d1a0pa1 was called d1a0p_1 in SCOP 1.71
  
• d1a0pa1 appears in SCOP 1.75
  
• d1a0pa1 appears in the current release, SCOPe 2.08