Lineage for d1a0p_1 (1a0p 3-100)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48869Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 48870Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 48889Protein Recombinase XerD [47827] (1 species)
  7. 48890Species Escherichia coli [TaxId:562] [47828] (1 PDB entry)
  8. 48891Domain d1a0p_1: 1a0p 3-100 [18105]
    Other proteins in same PDB: d1a0p_2

Details for d1a0p_1

PDB Entry: 1a0p (more details), 2.5 Å

PDB Description: site-specific recombinase, xerd

SCOP Domain Sequences for d1a0p_1:

Sequence, based on SEQRES records: (download)

>d1a0p_1 a.60.9.1 (3-100) Recombinase XerD {Escherichia coli}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
leggykatssarllsavrrlfqylyrekfreddpsahl

Sequence, based on observed residues (ATOM records): (download)

>d1a0p_1 a.60.9.1 (3-100) Recombinase XerD {Escherichia coli}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
lssarllsavrrlfqylyrekfreddpsahl

SCOP Domain Coordinates for d1a0p_1:

Click to download the PDB-style file with coordinates for d1a0p_1.
(The format of our PDB-style files is described here.)

Timeline for d1a0p_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0p_2