SCOPe 2.04: Domain d3md1b_: 3md1 B:

Lineage for d3md1b_ (3md1 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (7 PDB entries)

8. Domain d3md1b_: 3md1 B: [181014]
   automated match to d1x5sa1
   complexed with gol

Details for d3md1b_

PDB Entry: 3md1, 1.6 Å

PDB Description: Crystal Structure of the Second RRM Domain of Yeast Poly(U)-Binding Protein (Pub1)

PDB Compounds: (B:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d3md1b_:

Sequence; same for both SEQRES and ATOM records:

>d3md1b_ d.58.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
dsmqgqdlngrplrinwaa

Timeline for d3md1b_:

• d3md1b_ first appeared in SCOPe 2.01
  
• d3md1b_ appears in SCOPe 2.03
  
• d3md1b_ appears in SCOPe 2.05
  
• d3md1b_ appears in the current release, SCOPe 2.08