SCOPe 2.07: Domain d3mc0c_: 3mc0 C:

Lineage for d3mc0c_ (3mc0 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3mc0c_: 3mc0 C: [181000]
   Other proteins in same PDB: d3mc0b1, d3mc0b2, d3mc0d1, d3mc0d2
   automated match to d2aq3a1
   complexed with act

Details for d3mc0c_

PDB Entry: 3mc0, 2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain

PDB Compounds: (C:) variable beta 8.2 mouse T cell receptor

SCOPe Domain Sequences for d3mc0c_:

Sequence; same for both SEQRES and ATOM records:

>d3mc0c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

Timeline for d3mc0c_:

• d3mc0c_ first appeared in SCOPe 2.01
  
• d3mc0c_ appears in SCOPe 2.06
  
• d3mc0c_ appears in the current release, SCOPe 2.08