SCOPe 2.05: Domain d3m9qb_: 3m9q B:

Lineage for d3m9qb_ (3m9q B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (4 PDB entries)

8. Domain d3m9qb_: 3m9q B: [180977]
   automated match to d2efia1
   protein/DNA complex

Details for d3m9qb_

PDB Entry: 3m9q, 1.29 Å

PDB Description: drosophila msl3 chromodomain

PDB Compounds: (B:) Protein male-specific lethal-3

SCOPe Domain Sequences for d3m9qb_:

Sequence; same for both SEQRES and ATOM records:

>d3m9qb_ b.34.13.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfyeykihfqgwrpsy
dravratvllkdteenrqlqrelaeaa

Timeline for d3m9qb_:

• d3m9qb_ first appeared in SCOPe 2.01
  
• d3m9qb_ appears in SCOPe 2.04
  
• d3m9qb_ appears in SCOPe 2.06
  
• d3m9qb_ appears in the current release, SCOPe 2.08