Lineage for d3m9qa_ (3m9q A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947418Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 947564Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 947565Protein automated matches [191139] (2 species)
    not a true protein
  7. 947566Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (1 PDB entry)
  8. 947567Domain d3m9qa_: 3m9q A: [180976]
    automated match to d2efia1
    protein/DNA complex

Details for d3m9qa_

PDB Entry: 3m9q (more details), 1.29 Å

PDB Description: drosophila msl3 chromodomain
PDB Compounds: (A:) Protein male-specific lethal-3

SCOPe Domain Sequences for d3m9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m9qa_ b.34.13.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfyeykihfqgwrpsy
dravratvllkdteenrqlqrelaeaakl

SCOPe Domain Coordinates for d3m9qa_:

Click to download the PDB-style file with coordinates for d3m9qa_.
(The format of our PDB-style files is described here.)

Timeline for d3m9qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3m9qb_