SCOPe 2.05: Domain d3m9kb_: 3m9k B:

Lineage for d3m9kb_ (3m9k B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d3m9kb_: 3m9k B: [180975]
   automated match to d1erva_
   complexed with d1d, so4; mutant

Details for d3m9kb_

PDB Entry: 3m9k, 1.5 Å

PDB Description: crystal structure of human thioredoxin c69/73s double-mutant, oxidized form

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d3m9kb_:

Sequence; same for both SEQRES and ATOM records:

>d3m9kb_ c.47.1.1 (B:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv

Timeline for d3m9kb_:

• d3m9kb_ first appeared in SCOPe 2.01
  
• d3m9kb_ appears in SCOPe 2.04
  
• d3m9kb_ appears in SCOPe 2.06
  
• d3m9kb_ appears in the current release, SCOPe 2.08