SCOPe 2.08: Domain d3m95b1: 3m95 B:1-115

Lineage for d3m95b1 (3m95 B:1-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [189398] (1 PDB entry)

8. Domain d3m95b1: 3m95 B:1-115 [180967]
   Other proteins in same PDB: d3m95b2
   automated match to d1kota_

Details for d3m95b1

PDB Entry: 3m95, 2.4 Å

PDB Description: Crystal structure of autophagy-related protein Atg8 from the silkworm Bombyx mori

PDB Compounds: (B:) Autophagy related protein Atg8

SCOPe Domain Sequences for d3m95b1:

Sequence; same for both SEQRES and ATOM records:

>d3m95b1 d.15.1.3 (B:1-115) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mkfqykeehsfekrkaegekirrkypdrvpvivekapkarlgdldkkkylvpsdltvgqf
yflirkrihlrpedalfffvnnvipptsatmgslyqehhdedfflyiafsdenvy

Timeline for d3m95b1:

• d3m95b1 first appeared in SCOPe 2.01, called d3m95b_
  
• d3m95b1 appears in SCOPe 2.07