![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.60: SAM domain-like [47768] (10 superfamilies) |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins) |
![]() | Protein Fen-1 nuclease [47817] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:186497] [47818] (1 PDB entry) |
![]() | Domain d1b43a1: 1b43 A:220-339 [18092] Other proteins in same PDB: d1b43a2, d1b43b2 |
PDB Entry: 1b43 (more details), 2 Å
SCOP Domain Sequences for d1b43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b43a1 a.60.7.1 (A:220-339) Fen-1 nuclease {Pyrococcus furiosus} ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr
Timeline for d1b43a1: