Lineage for d3m7qb1 (3m7q B:1-55)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637525Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries)
  8. 2637526Domain d3m7qb1: 3m7q B:1-55 [180912]
    Other proteins in same PDB: d3m7qa_, d3m7qb2, d3m7qb3
    automated match to d1shpa_
    complexed with po4

Details for d3m7qb1

PDB Entry: 3m7q (more details), 1.7 Å

PDB Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean sea anemone stichodactyla helianthus in complex with bovine pancreatic trypsin
PDB Compounds: (B:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3m7qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m7qb1 g.8.1.1 (B:1-55) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra

SCOPe Domain Coordinates for d3m7qb1:

Click to download the PDB-style file with coordinates for d3m7qb1.
(The format of our PDB-style files is described here.)

Timeline for d3m7qb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3m7qa_