Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein automated matches [190046] (3 species) not a true protein |
Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries) |
Domain d3m7qb1: 3m7q B:1-55 [180912] Other proteins in same PDB: d3m7qa_, d3m7qb2, d3m7qb3 automated match to d1shpa_ complexed with po4 |
PDB Entry: 3m7q (more details), 1.7 Å
SCOPe Domain Sequences for d3m7qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m7qb1 g.8.1.1 (B:1-55) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra
Timeline for d3m7qb1: