Lineage for d3m5jc_ (3m5j C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531658Species Influenza A virus [TaxId:490450] [189473] (3 PDB entries)
  8. 1531660Domain d3m5jc_: 3m5j C: [180869]
    Other proteins in same PDB: d3m5jb_, d3m5jd_, d3m5jf_
    automated match to d1ti8a1
    complexed with gol, nag

Details for d3m5jc_

PDB Entry: 3m5j (more details), 2.6 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin complexed with lstb
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3m5jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5jc_ b.19.1.2 (C:) automated matches {Influenza A virus [TaxId: 490450]}
gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
atgmrnvpe

SCOPe Domain Coordinates for d3m5jc_:

Click to download the PDB-style file with coordinates for d3m5jc_.
(The format of our PDB-style files is described here.)

Timeline for d3m5jc_: