SCOPe 2.01: Domain d3m52b_: 3m52 B:

Lineage for d3m52b_ (3m52 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (10 PDB entries)

8. Domain d3m52b_: 3m52 B: [180858]
   automated match to d1r28a_
   complexed with act, zn

Details for d3m52b_

PDB Entry: 3m52, 2.59 Å

PDB Description: Crystal structure of the BTB domain from the Miz-1/ZBTB17 transcription regulator

PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 17

SCOPe Domain Sequences for d3m52b_:

Sequence; same for both SEQRES and ATOM records:

>d3m52b_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkd
vvhldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksla

Timeline for d3m52b_:

• d3m52b_ is new in SCOPe 2.01-stable
  
• d3m52b_ appears in SCOPe 2.02
  
• d3m52b_ appears in the current release, SCOPe 2.08, called d3m52b1