Lineage for d3m4ha_ (3m4h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829201Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2829202Species Human (Homo sapiens) [TaxId:9606] [51437] (156 PDB entries)
    Uniprot P15121
  8. 2829209Domain d3m4ha_: 3m4h A: [180854]
    automated match to d1pwla_
    complexed with 388, br, cit, nap; mutant

Details for d3m4ha_

PDB Entry: 3m4h (more details), 0.94 Å

PDB Description: Human Aldose Reductase mutant T113V complexed with IDD388
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d3m4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4ha_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwpvgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
llsctshkdypfheef

SCOPe Domain Coordinates for d3m4ha_:

Click to download the PDB-style file with coordinates for d3m4ha_.
(The format of our PDB-style files is described here.)

Timeline for d3m4ha_: