SCOP 1.75: Domain d1taua1: 1tau A:174-289

Lineage for d1taua1 (1tau A:174-289)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)

8. Domain d1taua1: 1tau A:174-289 [18085]
   Other proteins in same PDB: d1taua2, d1taua3, d1taua4
   protein/DNA complex; complexed with bgl, zn

Details for d1taua1

PDB Entry: 1tau, 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

PDB Compounds: (A:) protein (taq polymerase)

SCOP Domain Sequences for d1taua1:

Sequence; same for both SEQRES and ATOM records:

>d1taua1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

Timeline for d1taua1:

• d1taua1 first appeared (with stable ids) in SCOP 1.55
  
• d1taua1 appears in SCOP 1.73
  
• d1taua1 appears in SCOPe 2.01
  
• d1taua1 appears in the current release, SCOPe 2.08