SCOP 1.75: Domain d1cmwa1: 1cmw A:174-289

Lineage for d1cmwa1 (1cmw A:174-289)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)

8. Domain d1cmwa1: 1cmw A:174-289 [18084]
   Other proteins in same PDB: d1cmwa2, d1cmwa3, d1cmwa4

Details for d1cmwa1

PDB Entry: 1cmw, 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

PDB Compounds: (A:) protein (DNA polymerase I)

SCOP Domain Sequences for d1cmwa1:

Sequence; same for both SEQRES and ATOM records:

>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

Timeline for d1cmwa1:

• d1cmwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cmwa1 appears in SCOP 1.73
  
• d1cmwa1 does not appear in SCOPe 2.01