SCOPe 2.05: Domain d3m3zb_: 3m3z B:

Lineage for d3m3zb_ (3m3z B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (4 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries)

8. Domain d3m3zb_: 3m3z B: [180810]
   Other proteins in same PDB: d3m3za1, d3m3za2
   automated match to d1hx1b_
   complexed with 3f5

Details for d3m3zb_

PDB Entry: 3m3z, 2.1 Å

PDB Description: Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor

PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3m3zb_:

Sequence; same for both SEQRES and ATOM records:

>d3m3zb_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

Timeline for d3m3zb_:

• d3m3zb_ first appeared in SCOPe 2.01
  
• d3m3zb_ appears in SCOPe 2.04
  
• d3m3zb_ is called d3m3zb1 in SCOPe 2.06
  
• d3m3zb_ appears in the current release, SCOPe 2.08, called d3m3zb1