Lineage for d1tfr_1 (1tfr 183-305)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) 
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) 
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins) Protein T4 RNase H [47809] (1 species) Species Bacteriophage T4 [TaxId:10665] [47810] (1 PDB entry) 
Domain d1tfr_1: 1tfr 183-305 [18081]
Other proteins in same PDB: d1tfr_2
Details for d1tfr_1
PDB Entry: 1tfr (more details), 2.06 Å
PDB Description: rnase h from bacteriophage t4
SCOP Domain Sequences for d1tfr_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfr_1 a.60.7.1 (183-305) T4 RNase H {Bacteriophage T4}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef
SCOP Domain Coordinates for d1tfr_1:
Click to download the PDB-style file with coordinates for d1tfr_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfr_1:
- d1tfr_1 appears in SCOP 1.57
- d1tfr_1 appears in the current release, SCOPe 2.08, called d1tfra1
View in 3D
