Lineage for d1bno__ (1bno -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.60: SAM domain-like [47768] (11 superfamilies) 
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) 
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) 
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) 
Domain d1bno__: 1bno - [18079]
Details for d1bno__
PDB Entry: 1bno (more details)
PDB Description: nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
SCOP Domain Sequences for d1bno__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bno__ a.60.6.1 (-) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
klpgvgtkiaekideflatgklrklek
SCOP Domain Coordinates for d1bno__:
Click to download the PDB-style file with coordinates for d1bno__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bno__:
- d1bno__ first appeared (with stable ids) in SCOP 1.55
- d1bno__ appears in SCOP 1.59
- d1bno__ appears in SCOP 1.63
- d1bno__ appears in the current release, SCOPe 2.08, called d1bnoa_
View in 3D