Lineage for d1dk2a_ (1dk2 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98661Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 98662Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 98663Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 98755Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 98764Domain d1dk2a_: 1dk2 A: [18078]

Details for d1dk2a_

PDB Entry: 1dk2 (more details)

PDB Description: refined solution structure of the n-terminal domain of dna polymerase beta

SCOP Domain Sequences for d1dk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk2a_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
skrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakk
lpgvgtkiaekideflatgklrklek

SCOP Domain Coordinates for d1dk2a_:

Click to download the PDB-style file with coordinates for d1dk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk2a_: