Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) |
Domain d1dk3a_: 1dk3 A: [18077] |
PDB Entry: 1dk3 (more details)
SCOP Domain Sequences for d1dk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dk3a_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)} mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak klpgvgtkiaekideflatgklrklek
Timeline for d1dk3a_: