Lineage for d1dk3a_ (1dk3 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356901Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 356902Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 356903Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 356997Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 357009Domain d1dk3a_: 1dk3 A: [18077]

Details for d1dk3a_

PDB Entry: 1dk3 (more details)

PDB Description: refined solution structure of the n-terminal domain of dna polymerase beta

SCOP Domain Sequences for d1dk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk3a_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
klpgvgtkiaekideflatgklrklek

SCOP Domain Coordinates for d1dk3a_:

Click to download the PDB-style file with coordinates for d1dk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk3a_: