SCOPe 2.06: Domain d1bpea1: 1bpe A:12-91

Lineage for d1bpea1 (1bpe A:12-91)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries)

8. Domain d1bpea1: 1bpe A:12-91 [18076]
   Other proteins in same PDB: d1bpea2, d1bpea3
   partly disordered
   complexed with dtp

Details for d1bpea1

PDB Entry: 1bpe, 2.9 Å

PDB Description: crystal structure of rat dna polymerase beta; evidence for a common polymerase mechanism

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1bpea1:

Sequence, based on SEQRES records:

>d1bpea1 a.60.6.1 (A:12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtkiae
kideflatgklrklekirrd

Sequence, based on observed residues (ATOM records):

>d1bpea1 a.60.6.1 (A:12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nggitdmlvelanfgaeakklpekideflatgklrklekirrd

Timeline for d1bpea1:

• d1bpea1 first appeared (with stable ids) in SCOP 1.55, called d1bpe_1
  
• d1bpea1 appears in SCOPe 2.05
  
• d1bpea1 appears in SCOPe 2.07
  
• d1bpea1 appears in the current release, SCOPe 2.08