Lineage for d1bpe_1 (1bpe 12-91)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153816Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 153817Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 153818Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 153910Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 153923Domain d1bpe_1: 1bpe 12-91 [18076]
    Other proteins in same PDB: d1bpe_2

Details for d1bpe_1

PDB Entry: 1bpe (more details), 3.9 Å

PDB Description: crystal structure of rat dna polymerase beta; evidence for a common polymerase mechanism

SCOP Domain Sequences for d1bpe_1:

Sequence, based on SEQRES records: (download)

>d1bpe_1 a.60.6.1 (12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
nggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtkiae
kideflatgklrklekirrd

Sequence, based on observed residues (ATOM records): (download)

>d1bpe_1 a.60.6.1 (12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
nggitdmlvelanfgaeakklpekideflatgklrklekirrd

SCOP Domain Coordinates for d1bpe_1:

Click to download the PDB-style file with coordinates for d1bpe_1.
(The format of our PDB-style files is described here.)

Timeline for d1bpe_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpe_2