Class a: All alpha proteins [46456] (171 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) |
Domain d2bpga1: 2bpg A:9-91 [18074] Other proteins in same PDB: d2bpga3, d2bpga4, d2bpgb3, d2bpgb4 |
PDB Entry: 2bpg (more details), 3.6 Å
SCOP Domain Sequences for d2bpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpga1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)} etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk iaekideflatgklrklekirqd
Timeline for d2bpga1: