Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries) |
Domain d3m0ta_: 3m0t A: [180688] automated match to d1pwta_ complexed with so4; mutant |
PDB Entry: 3m0t (more details), 1.7 Å
SCOPe Domain Sequences for d3m0ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m0ta_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} kelvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
Timeline for d3m0ta_: