Lineage for d3m0ba_ (3m0b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009508Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 3009509Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 3009510Family d.278.1.1: H-NOX domain [111127] (2 proteins)
    binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
    automatically mapped to Pfam PF07700
  6. 3009554Protein automated matches [191120] (2 species)
    not a true protein
  7. 3009558Species Thermoanaerobacter tengcongensis [TaxId:119072] [189186] (1 PDB entry)
  8. 3009559Domain d3m0ba_: 3m0b A: [180681]
    automated match to d1u4ha_
    complexed with cmo, rur

Details for d3m0ba_

PDB Entry: 3m0b (more details), 2 Å

PDB Description: Ru-Porphyrin Protein Scaffolds for Sensing O2
PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d3m0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0ba_ d.278.1.1 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfey

SCOPe Domain Coordinates for d3m0ba_:

Click to download the PDB-style file with coordinates for d3m0ba_.
(The format of our PDB-style files is described here.)

Timeline for d3m0ba_: