Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) |
Family d.278.1.1: H-NOX domain [111127] (2 proteins) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains automatically mapped to Pfam PF07700 |
Protein automated matches [191120] (2 species) not a true protein |
Species Thermoanaerobacter tengcongensis [TaxId:119072] [189186] (1 PDB entry) |
Domain d3m0ba_: 3m0b A: [180681] automated match to d1u4ha_ complexed with cmo, rur |
PDB Entry: 3m0b (more details), 2 Å
SCOPe Domain Sequences for d3m0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m0ba_ d.278.1.1 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvfey
Timeline for d3m0ba_: