Lineage for d3lzgi_ (3lzg I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778228Domain d3lzgi_: 3lzg I: [180667]
    Other proteins in same PDB: d3lzgb_, d3lzgd_, d3lzgf_, d3lzgh_, d3lzgj_, d3lzgl_
    automated match to d1ruyh_
    complexed with nag

Details for d3lzgi_

PDB Entry: 3lzg (more details), 2.6 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin
PDB Compounds: (I:) Hemagglutinin, HA1 SUBUNIT

SCOPe Domain Sequences for d3lzgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzgi_ b.19.1.2 (I:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3lzgi_:

Click to download the PDB-style file with coordinates for d3lzgi_.
(The format of our PDB-style files is described here.)

Timeline for d3lzgi_: