Lineage for d1zqta1 (1zqt A:9-91)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153816Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 153817Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 153818Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 153819Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)
  8. 153903Domain d1zqta1: 1zqt A:9-91 [18064]
    Other proteins in same PDB: d1zqta2

Details for d1zqta1

PDB Entry: 1zqt (more details), 3.4 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of datp (0.01 millimolar) and zncl2 (0.02 millimolar)

SCOP Domain Sequences for d1zqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqta1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d1zqta1:

Click to download the PDB-style file with coordinates for d1zqta1.
(The format of our PDB-style files is described here.)

Timeline for d1zqta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zqta2