SCOPe 2.03: Domain d7icja1: 7icj A:9-91

Lineage for d7icja1 (7icj A:9-91)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (132 PDB entries)
   Uniprot P06746

8. Domain d7icja1: 7icj A:9-91 [18063]
   Other proteins in same PDB: d7icja3, d7icja4
   protein/DNA complex; complexed with cu, na

Details for d7icja1

PDB Entry: 7icj, 3.5 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of cucl2 (0.1 millimolar)

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d7icja1:

Sequence; same for both SEQRES and ATOM records:

>d7icja1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d7icja1:

• d7icja1 first appeared (with stable ids) in SCOP 1.55
  
• d7icja1 appears in SCOPe 2.02
  
• d7icja1 appears in SCOPe 2.04
  
• d7icja1 appears in the current release, SCOPe 2.08