Lineage for d3lxra_ (3lxr A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988400Protein RhoA [52612] (1 species)
  7. 988401Species Human (Homo sapiens) [TaxId:9606] [52613] (19 PDB entries)
    Uniprot P61586 2-181
  8. 988403Domain d3lxra_: 3lxr A: [180627]
    automated match to d1x86b_
    complexed with gdp, so4

Details for d3lxra_

PDB Entry: 3lxr (more details), 1.68 Å

PDB Description: Shigella IpgB2 in complex with human RhoA and GDP (complex C)
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d3lxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxra_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d3lxra_:

Click to download the PDB-style file with coordinates for d3lxra_.
(The format of our PDB-style files is described here.)

Timeline for d3lxra_: