Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries) |
Domain d8icha1: 8ich A:9-91 [18062] Other proteins in same PDB: d8icha3, d8icha4 protein/DNA complex; complexed with na |
PDB Entry: 8ich (more details), 3.3 Å
SCOP Domain Sequences for d8icha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icha1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)} etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk iaekideflatgklrklekirqd
Timeline for d8icha1: