SCOPe 2.05: Domain d3lxfc_: 3lxf C:

Lineage for d3lxfc_ (3lxf C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (14 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [189373] (1 PDB entry)

8. Domain d3lxfc_: 3lxf C: [180619]
   automated match to d1e9ma_
   complexed with fes

Details for d3lxfc_

PDB Entry: 3lxf, 2.3 Å

PDB Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans

PDB Compounds: (C:) ferredoxin

SCOPe Domain Sequences for d3lxfc_:

Sequence; same for both SEQRES and ATOM records:

>d3lxfc_ d.15.4.0 (C:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
palsgdendlldssdhrtphsrlscqitindklegleveiaped

Timeline for d3lxfc_:

• d3lxfc_ first appeared in SCOPe 2.01
  
• d3lxfc_ appears in SCOPe 2.04
  
• d3lxfc_ appears in SCOPe 2.06
  
• d3lxfc_ appears in the current release, SCOPe 2.08