SCOPe 2.01: Domain d3lwea_: 3lwe A:

Lineage for d3lwea_ (3lwe A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189257] (5 PDB entries)

8. Domain d3lwea_: 3lwe A: [180604]
   automated match to d2dnta1

Details for d3lwea_

PDB Entry: 3lwe, 2.05 Å

PDB Description: the crystal structure of mpp8

PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3lwea_:

Sequence; same for both SEQRES and ATOM records:

>d3lwea_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
a

Timeline for d3lwea_:

• d3lwea_ is new in SCOPe 2.01-stable
  
• d3lwea_ appears in SCOPe 2.02
  
• d3lwea_ appears in the current release, SCOPe 2.08