SCOPe 2.06: Domain d3lw8a1: 3lw8 A:2-181

Lineage for d3lw8a1 (3lw8 A:2-181)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (26 PDB entries)
   Uniprot P61586 2-181

8. Domain d3lw8a1: 3lw8 A:2-181 [180600]
   Other proteins in same PDB: d3lw8a2, d3lw8b2, d3lw8c2, d3lw8d2
   automated match to d1x86b_
   complexed with gdp, mg

Details for d3lw8a1

PDB Entry: 3lw8, 1.85 Å

PDB Description: Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex A)

PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d3lw8a1:

Sequence; same for both SEQRES and ATOM records:

>d3lw8a1 c.37.1.8 (A:2-181) RhoA {Human (Homo sapiens) [TaxId: 9606]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

Timeline for d3lw8a1:

• d3lw8a1 first appeared in SCOPe 2.01, called d3lw8a_
  
• d3lw8a1 was called d3lw8a_ in SCOPe 2.05
  
• d3lw8a1 appears in SCOPe 2.07
  
• d3lw8a1 appears in the current release, SCOPe 2.08