Lineage for d3lw0c_ (3lw0 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220897Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1220898Species Human (Homo sapiens) [TaxId:9606] [69826] (15 PDB entries)
  8. 1220903Domain d3lw0c_: 3lw0 C: [180596]
    automated match to d1p4ob_
    complexed with ccx, gol

Details for d3lw0c_

PDB Entry: 3lw0 (more details), 1.79 Å

PDB Description: igf-1rk in complex with ligand msc1609119a-1
PDB Compounds: (C:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3lw0c_:

Sequence, based on SEQRES records: (download)

>d3lw0c_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
aadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmr
erieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpamannp
vlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiye
tdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvl
rfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyys
eenk

Sequence, based on observed residues (ATOM records): (download)

>d3lw0c_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
aadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmr
erieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpppslsk
miqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkgll
pvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkp
dncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOPe Domain Coordinates for d3lw0c_:

Click to download the PDB-style file with coordinates for d3lw0c_.
(The format of our PDB-style files is described here.)

Timeline for d3lw0c_: